MétaCan
Menu
Back to cohort
Record W2898812156 · doi:10.1016/j.jcmgh.2018.10.012

Proteolytic Processing of the Epithelial Adherens Junction Molecule E-Cadherin by Neutrophil Elastase Generates Short Peptides With Novel Wound-Healing Bioactivity

2018· letter· en· W2898812156 on OpenAlexafffund
Marilyn Gordon, Anaïs Chauvin, François‐Michel Boisvert, Wallace K. MacNaughton

Bibliographic record

VenueCellular and Molecular Gastroenterology and Hepatology · 2018
Typeletter
Languageen
FieldBiochemistry, Genetics and Molecular Biology
TopicInflammatory Bowel Disease
Canadian institutionsUniversité de SherbrookeUniversity of Calgary
FundersNatural Sciences and Engineering Research Council of CanadaCrohn's and Colitis CanadaUniversity of Calgary
KeywordsAdherens junctionWound healingProteasesNeutrophil elastaseInflammatory bowel diseaseMedicineElastaseImmunologyContext (archaeology)Ulcerative colitisProinflammatory cytokineCadherinInflammationDiseaseBiologyPathologyCellEnzyme

Abstract

fetched live from OpenAlex

We report the novel observation that the inflammatory protease, neutrophil elastase (NE), present in high abundance in inflamed tissue in inflammatory bowel disease (IBD) patients, is capable of cleaving the cellular adherens junction protein, E-cadherin. Proteolysis of E-cadherin by NE generates a variety of short peptides, several of which were observed in patient tissue samples, showing biological activity to promote wound closure in an in vitro model system. This effect is independent of proliferation either in a wounded monolayer or under subconfluent conditions, suggesting a primarily migratory activity upon colonic epithelial monolayers. We report the novel observation that inflammatory proteases post-translationally modify cellular junction proteins to create signaling peptides that contribute to the wound healing response and identifies a new mechanism of mucosal healing to be examined further in the context of chronic inflammatory diseases. IBDs, including ulcerative colitis and Crohn’s disease, comprise a spectrum of chronic inflammatory gastrointestinal diseases of complex etiology. Although there is no one defined cause or trigger for IBD, the unifying feature across the spectrum of IBD is the concept of chronic relapsing and remitting inflammatory disease, primarily in the colon (although in Crohn’s disease inflammation may occur anywhere along the gastrointestinal tract).1Zhang Y. et al.World J Gastroenterol. 2014; 20: 91-99Crossref PubMed Scopus (678) Google Scholar Mucosal healing now is considered the current gold standard in assessing IBD therapeutic remission,2Atreya R. et al.Visceral Med. 2017; 33: 82-88Crossref PubMed Scopus (32) Google Scholar however, our understanding of how and why many patients fail to achieve healing remains poorly elucidated. Upon an inflammatory stimulus, the intestinal epithelial monolayer is compromised by bacterial insult at the luminal surface as collateral damage from degranulation and an oxidative burst from lamina propria granulocytes, primarily neutrophils, and from cytokines released from leukocytes.3Parkos C.A. Am J Pathol. 2016; 186: 1404-1416Abstract Full Text Full Text PDF PubMed Scopus (61) Google Scholar Neutrophils are the first immune cells recruited to areas of inflammation in IBD and sustained high infiltration of activated neutrophils in inflamed tissue is a hallmark of disease.4Brazil J. et al.Inflamm Bowel Dis. 2013; 19: 1556-1565Crossref PubMed Scopus (89) Google Scholar However, neutrophils now also are considered to be important players in the resolution phase of the inflammatory response.5Fournier B.M. et al.Mucosal Immunol. 2012; 5: 354-366Crossref PubMed Scopus (400) Google Scholar, 6Colgan S.P. Semin Immunol. 2015; 27: 177-183Crossref PubMed Scopus (32) Google Scholar Neutrophils can interact directly with epithelial cells by transmigrating through epithelia and interacting with apical intercellular adhesion molecule 1 to enhance wound healing through activation of the Akt and β-catenin pathways.7Sumagin R. et al.Mucosal Immunol. 2016; 9: 1151-1162Crossref PubMed Scopus (68) Google Scholar Damage to the intestinal epithelium causes a shift from a tight barrier to a migratory/repair phenotype, a process that involves the proteolytic cleavage of junctional proteins such as E-cadherin. Proteases can cleave epithelial junctional proteins to generate peptides that have biological activity that can affect the intestinal mucosa,8Nava P. et al.Mol Biol Cell. 2007; 18: 4565-4578Crossref PubMed Scopus (91) Google Scholar and recently NE was shown to cleave E-cadherin in bronchial epithelial cells,9Boxio R. et al.Respir Res. 2016; 17: 129Crossref PubMed Scopus (40) Google Scholar although the potential effects of E-cadherin degradation peptides was not assessed in that study. Of particular interest is the recent observation that NE can be internalized by cells and is thus capable of processing both intracellular and extracellular substrates.10Gregory AD, et al. J Biol Chem 2012;287:35341–35350.Google Scholar, 11Kerros C. et al.J Biol Chem. 2017; 292: 10295-10305Crossref PubMed Scopus (24) Google Scholar In this context, we examined whether the inflammatory protease NE could proteolytically cleave the adherens junction protein E-cadherin and, specifically, whether the peptides resulting from this cleavage event could affect epithelial wound healing. We first used a cell-free system to digest human recombinant E-cadherin with purified human NE and used liquid chromatography tandem mass spectrometry (LC-MS/MS) to identify the resulting peptides and cleavage events that occurred. We found that NE was capable of cleaving E-cadherin efficiently, with 48 peptides identified with high confidence using mass spectrometry. Of these 48 peptides, we focused on 24 of these based on their frequency of occurrence, P value scoring, and accessibility of peptide cleavage site to proteases (Supplementary Table 1 and Supplementary Figure 1A and B). To further focus on the most physiologically relevant peptides, we sought to confirm the presence of these peptides in patient tissues. By using a modified extraction protocol, we obtained protein/peptide fractions from banked formalin-fixed, paraffin-embedded IBD and control samples, and identified peptides originating from E-cadherin using mass spectrometry enriched in IBD samples. Six of these peptides showed substantial overlap with 6 peptides identified from our cell-free digest, and we chose these 6 peptides for biological activity screening (Table 1). First, we tested our peptides for effects on wound healing capacity using a scratch assay, under both 10% serum and serum-free conditions, over 48 hours at concentrations of 1, 10, and 100 μg/mL using a high-throughput protocol we designed for the Incucyte live cell imaging system (EssenBiosciences Inc, Ann Arbor, MI) (see the Supplementary Methods section for detailed methodologies). Three peptides, designated E-cadherin peptide (EP)-15, EP-17, and EP-22, at concentrations of 100, 1, and 10 μg/mL, respectively, showed increased wound closure compared with untreated and vehicle controls, in both 10% serum (Figure 1) and serum-free (Supplementary Figure 1C) conditions. The peptides appeared to have a synergistic effect with 10% serum.Table 1Alignment of E-Cadherin Peptides Generated by Neutrophil Elastase In Vitro With Peptide Fragments Isolated From IBD Patient TissuePeptidePositionOverlapTAYFSLDTR66-74NoneVTEPLDR216-222NoneNTGVISVVTTGLDR332-335EP-22KNMFTINRNTGVISVVTTGLDRESFPTYTLGQVPENEANVVITTLK382-397EP-13, partially EP-23IFNPTTYKGQVPENEANVVITTLKVTDADAPNTVTDTNDNPPIFNPTTYKGQVPENEANVVITTLKVTDADAPNDTANWLEINPDTGA528-541NoneISTRAELDR542-550NoneTIFFCER559-565NoneMALEVGDYK656-664NoneEPLLPPEDDTR739-749EP-17LRRRAVVKEPLLPPEDDTRDNVYYYDEGLDARPEVTR775-784Partially EP-14FDLSQLHRGLDARPEVTRNDVAPTLMNDVAPTLMSVPR785-796EP-14DARPEVTRNDVAPTLMSVPRYLPRPANPPANPDEIGNFIDENLK801-816Partially EP-15SVPRYLPRPANPDEIGNFIDENLKAADTDPTAPPYDNOTE. The left column indicates the peptides identified in patient tissue, the second column shows its position in the full E-cadherin protein, and the right columns indicate overlap with in vitro neutrophil elastase digestion of E-cadherin. Highlighted text indicates peptides identified in patient samples, and underlined text indicates peptides before trypsin treatment. Boxed text indicates E-cadherin peptides generated by NE cleavage. Open table in a new tab NOTE. The left column indicates the peptides identified in patient tissue, the second column shows its position in the full E-cadherin protein, and the right columns indicate overlap with in vitro neutrophil elastase digestion of E-cadherin. Highlighted text indicates peptides identified in patient samples, and underlined text indicates peptides before trypsin treatment. Boxed text indicates E-cadherin peptides generated by NE cleavage. The pro-healing effect was replicated by NE in a concentration-dependent manner, with 1 ng/mL having a small but significant effect in the presence of serum (Supplementary Figure 1D). The effect of NE was dependent on its catalytic activity because the effect on wound healing was blocked with heat denaturation, which was confirmed to significantly reduce NE activity (Supplementary Figure 1E). To determine whether this effect was due to an increase in the proliferation of cells in response to the presence of E-cadherin peptides, we used the 5-Ethynyl-2′-deoxyuridine (EdU) system to identify actively dividing cells and found that there was no significant difference in proliferation under serum-free or serum conditions. Concurrently, we used the terminal deoxynucleotidyl transferase–mediated deoxyuridine triphosphate nick-end labeling enzyme to identify cell death to determine any cytotoxicity of our peptides at their effective doses and found no cytotoxicity of these peptides on Caco-2 monolayers (Supplementary Figure 2). To examine whether these peptides may have a mitogenic effect under nonwounding conditions, peptides also were tested for biological activity under subconfluent conditions. Caco-2 cells were transfected with a green fluorescent protein construct, seeded at medium density and exposed to the 6 peptides at the concentrations described earlier. Cell number and morphology were tracked over 48 hours. No significant changes in cell number or cell spreading were seen in response to any of the 6 peptides in either serum-free or 10% serum conditions (data not shown), suggesting that these peptides do not have mitogenic properties, and that the biological activity of the E-cadherin peptides is primarily to increase the migratory capacity under wound-healing conditions. To assess whether E-cadherin peptides could enter Caco-2 cells to potentially evoke intracellular signaling pathways, 7-amino-4-methylcoumarin (AMC) fluorescently tagged versions of EP-15 and EP-17 were synthesized and shown to transmigrate across the plasma membrane and into the cytosol (Supplementary Figure 3). In this research letter, we show the ability of an inflammatory protease, neutrophil elastase, to process the adherens junction protein E-cadherin to generate short peptide fragments with effects on epithelial function, and a novel role for low levels of NE being pro-resolution. These peptide fragments are present in IBD patient tissues and appear to enhance the wound-healing response of intestinal epithelial cell monolayers independently of cellular proliferation. Our study raises important questions about the cellular mechanism whereby NE-derived peptide fragments of E-cadherin stimulate an epithelial wound-healing response. Is the site of action of E-cadherin peptides on epithelial cells extracellular or intracellular, and what is the mechanism of transport across the cell membrane? What intracellular pathway(s) are altered by these peptides to modify epithelial cell behavior? Are other bioactive peptides proteolytically produced by NE or other inflammatory proteases as a resolution response, and what are the cellular targets of these peptides? Thus, our work provides the impetus for further research that will determine the signaling mechanisms underlying this phenomenon, identify potential new peptide biomarkers of inflammatory diseases, and develop new therapeutic targets. Overall, our discovery adds a new layer of complexity to our understanding of the signaling mechanisms underlying mucosal repair after inflammatory insult and suggests a new potential arm of repair signaling that may be dysregulated during IBD and other chronic inflammatory diseases. A total of 5 μg of recombinant E-cadherin (H00000999-P01; Abnova, Neihu District, Tapei City, Taiwan) was incubated in modified Hank's balanced salt solution (14175; Gibco, Waltham, MA) with 0.02 U purified human NE (E8140; Sigma-Aldrich, St. Louis, MO) for 1 minute at 37°C. The enzymatic reaction then was quenched with ice-cold 0.1% trifluoroacetic acid and snap frozen at -80°C. The sample was processed directly using high-performance liquid chromatography (HPLC)–MS/MS without additional clean-up on an Orbitrap Fusion (Thermo Scientific, Waltham, MA), and peptides were identified using MASCOT software (Matrix Science, Boston, MA). The final modified Hank's balanced salt solution composition consisted of the addition of HEPES, MgCl2, and CaCl2 to Hank's balanced salt solution as follows: 400 mg/L KCL, 60 mg/L KH2PO4, 350 mg/L NaHCO3, 8000 mg/L NaCl, 48 mg/L Na2HPO4, 1000 mg/L dextrose, 10 mmol/L HEPES pH 7.0, 1.5 mmol/L MgCl2, and 1.5 mmol/L CaCl2. Tissue samples were deparaffinized using a series of xylene–ethanol washes and dried completely before rehydration in high-performance liquid chromatography–grade water. Rehydrated samples then were homogenized/disrupted using a TissueRuptor (Qiagen, Venlo, Netherlands), and sodium dodecyl sulfate, Tris pH 7.5, and dithiothreitol added to the homogenized tissue to final concentrations of 2.5% sodium dodecyl sulfate, 50 mmol/L Tris pH 7.5, and 10 mmol/L dithiothreitol. Samples then were incubated at 98°C for 1 hour with vigorous vortexing of samples every 15 minutes. Samples then were centrifuged at 300 × g for 1 minute and the supernatants were collected into low-binding tubes. Samples then were concentrated using an Amicon Ultra 3K Spin column (UFC500324; Millipore, Burlington, MA), and the resulting concentrate was run on a 4%–12% sodium dodecyl sulfate–polyacrylamide electrophoresis gel. After staining with Coomassie Blue SimplyBlue SafeStain solution (LC6060; Thermo Scientific), lanes were excised from the gel and placed in new low-binding microtubes. Samples then were destained by washing with HPLC–grade water for 15 minutes with shaking, adding 1 volume acetonitrile and washing for 15 minutes with shaking and centrifuging for 1 minute at 300 × g. The wash supernatant then was removed from the samples and replaced with 20 mmol/L ammonium bicarbonate and washed with shaking for 15 minutes, followed by centrifugation for 1 minute at 300 × g. The wash supernatant then was removed from the samples and replaced with 20 mmol/L ammonium bicarbonate and acetonitrile (50:50 vol/vol), and washed for 15 minutes with shaking followed by centrifugation at 300 × g. The wash supernatant then was removed from the samples and replaced with acetonitrile to dehydrate samples until solid, and then dried using a Speedvac (Thermo Fisher Scientific). Samples then were digested using 12.5 ng/mL mass-spectrometry grade trypsin (90057; Pierce, Waltham, MA) reconstituted in ammonium bicarbonate 20 mmol/L at 30°C overnight. The peptide fraction then was recovered by adding 1 volume of acetonitrile and incubating at 30°C for 30 minutes with shaking followed by centrifugation at 300 × g for 1 minute. The supernatant was recovered to a new low-binding microtube and 1 volume of 1% formic acid was added to samples and incubated at 30°C for 20 minutes with shaking, followed by centrifugation at 300 × g for 1 minute. The supernatant was recovered and 1 volume was added and incubated at 30°C with shaking until solid, followed by centrifugation at 300 × g for 1 minute. Samples then were resuspended in 0.1% trifluoroacetic acid, and samples were cleaned using C18 Zip-Tips (ZTC18M960; Millipore) and run on HPLC-MS/MS. The Dionex Ultimate 3000 HPLC system was coupled to an OrbiTrap QExactive mass spectrometer via an EasySpray source (all Thermo Fisher Scientific, Inc). The spray voltage was used at 2.0 kV and the temperature of the column was 40°C. Full scan mass spectrometry survey spectra (m/z 350–1600) were acquired with a resolution of 70,000 after accumulation of 1,000,000 ions. The 10 most intense peptide ions then were fragmented by collision-induced dissociation at 35% energy with a resolution of 17,500, after accumulation of 50,000 ions. The maximal filling times were 250 ms for the full scans and 60 ms for the MS/MS scans. Singly, 7 and 8 charged precursor ions were rejected and a dynamic exclusion list was set to a maximum of 500 entries, a maximum retention period of 40 seconds, and a relative mass window of 10 ppm. The lock mass option was enabled for survey scans to improve mass accuracy. Caco2 human intestinal epithelial cells were grown in Dulbecco’s modified Eagle medium and Ham’s F12 (SH3002301; Hyclone, San Angelo, TX) supplemented with 10% fetal bovine serum (12483020; Gibco), 1% penicillin-streptomycin (SV30010; Hyclone), and 5 μg/mL Plasmocin (ANT-MPT; InvivoGen, San Diego, CA) maintained under standard cell culture conditions. Cells were maintained in a 37°C humidified incubator with 5% CO2. Media was changed in culture flasks every 2 days and cells were routinely passaged every 4 days at 80%–85% confluence using 1.5× trypsin-EDTA (T4174; Sigma-Aldrich), and cell numbers were quantified using a manual cytometer before plating. All experiments were performed using cells from passages 55–70. Caco2 cells were seeded into 96-well plates at a density of 5000 cells/well and grown under standard cell culture conditions, with media changes every 2 days. At 5 days after confluence, cells were wounded using the WoundMaker tool (Essen BioSciences). Wounded monolayers were washed twice with serum-free Dulbecco’s modified Eagle medium and Ham’s F12 to remove cellular debris and replaced with test media. Plates then were placed into the Incucyte live-cell imaging system (Essen BioSciences) maintained in a 37°C humidified incubator with 5% CO2, and whole-well phase images were taken every 2 hours for 48 hours. Confluency masks were generated using the Incucyte ZOOM software, and wound area over time was calculated using ImageJ (National Institutes of Health, Bethesda, MD). E-cadherin peptides were custom synthesized by NeoBiolabs (Woburn, MA) and reconstituted in sterile ddH2O. Purified human NE was obtained from Sigma Aldrich Purified human NE (E8140; Sigma was incubated at concentrations in modified Hank's balanced salt solution (see with the Elastase San Diego, CA) at a final of To the catalytic activity of the NE was at for 1 and of activity confirmed using the proteolytic processing of the was using a Waltham, MA), using a for peptides were by (Woburn, MA) and reconstituted in sterile ddH2O. Caco-2 monolayers 5 days after confluence were washed twice with Dulbecco’s modified Eagle medium and Ham’s F12 to remove cellular and replaced with test and incubated for and 4 hours. At the of the supernatants were removed and and cells were and collected in and supernatants and were placed into a and was using a using a for of wounded Caco-2 monolayers was performed using a modified protocol with the Waltham, MA) and the terminal deoxynucleotidyl transferase–mediated deoxyuridine triphosphate nick-end labeling in cell death cells were wounded and with test media as described earlier. hours before 10 was added to to to into dividing At 30 minutes, 24 and 48 the wounded Caco2 monolayers were in for 15 minutes, washed with bovine serum in and with (Thermo Fisher in at temperature for 20 minutes. were washed with bovine serum in and reaction and terminal deoxynucleotidyl transferase–mediated deoxyuridine triphosphate nick-end labeling reaction was added to and incubated at 37°C for 1 hour from Plates were washed times with bovine serum in and monolayers were with were taken using an A total of 5 Millipore) was used as a control for cell Caco2 cells were transfected with a to fluorescently cells using the with protocol transfected cell were obtained by using 400 μg/mL for cells then were into 96-well plates at 5000 to to the plates for with peptides, and over 48 hours using the Incucyte live-cell imaging system to the cell number by Cell spreading was by the cell area changes in the was performed using 5 software All at independent experiments with at independent and are as closure over time was using a of with All other were performed using a of with the or as All in this report with including at Figure of peptide of human E-cadherin generated by NE in cleavage of E-cadherin by NE as generated by et Res. PubMed Scopus Google Scholar The of the acid the relative observed The indicates the NE cleavage The cleavage site is E-cadherin peptides and significantly and healing in Caco-2 monolayers over 48 hours in the of compared with vehicle and untreated a of with the NE wound healing in Caco-2 Purified human NE showed a and wound-healing effect in Caco-2 monolayers over 48 hours in the presence of serum but not in the of serum The proteolytic activity of NE was confirmed to be significantly after heat compared with vehicle and untreated a of with the or with independent with or serum Figure Figure peptides do not significantly affect Caco-2 proliferation or Caco-2 cells were grown on and and with as a of cell proliferation terminal deoxynucleotidyl transferase–mediated deoxyuridine triphosphate nick-end labeling for cells and to show under and serum-free and and 10% serum conditions. images and of wounded monolayers and and for staining and staining at 48 hours. E-cadherin peptides no effect on either were seen at and times (data not a of with the independent with or Figure Figure peptides are capable of the to enter the cytosol of Caco-2 EP-15 and EP-17 the cytosol of Caco-2 monolayers 5 days after compared with vehicle and untreated of with the 4 independent with or Figure Table and of Peptide Fragments of E-Cadherin Generated by NE In 1 and 2 2 2 and Samples were by mass to show 24 are as as the of the E-cadherin that E-cadherin. Open table in a new tab NOTE. Samples were by mass to show 24 are as as the of the E-cadherin that E-cadherin.

Fetched live from OpenAlex and de-inverted. Abstracts are not stored in this database: the inverted indexes are 8.6 GB of the frame’s 9.3 GB of text, and the host has 13 GB free.

How this classification was reachedexpand

Full frame distilled prediction

Teacher imitation

Not calibrated prevalence, not ground truth. Human validation pending. Learned from the 10,348 direct Codex labels and 10,348 direct Gemma labels. Candidate is the union of thresholded teacher heads; consensus is their intersection. These outputs are machine_predicted_unvalidated and are not human labels or direct frontier model labels.

metaresearch head score (Codex)0.000
metaresearch head score (Gemma)0.000
Version: codex-gemma-dda1882f352aValidation status: machine_predicted_unvalidated
Candidate categoriesMeta-epidemiology (narrow)
Consensus categoriesnone
DomainCandidate signal: none · Consensus signal: none
Study designCandidate signal: Bench or experimental · Consensus signal: Bench or experimental
GenreCandidate signal: Empirical · Consensus signal: Empirical
Teacher disagreement score0.033
Threshold uncertainty score1.000

Codex and Gemma teacher scores by category

CategoryCodexGemma
Metaresearch0.0000.000
Meta-epidemiology (narrow)0.0010.000
Meta-epidemiology (broad)0.0010.000
Bibliometrics0.0000.000
Science and technology studies0.0000.001
Scholarly communication0.0000.000
Open science0.0000.000
Research integrity0.0010.001
Insufficient payload (model declined to judge)0.0000.000

Machine scores (provisional)

The two teacher heads of the student model, read on this work. A score orders the frame for review; it never asserts a category, and the validation status ships verbatim with every row.

Baseline scores from an immature model (maturity gate not passed, 7 training rounds). Scores rank; they never assert a category.

Opus teacher head0.007
GPT teacher head0.201
Teacher spread0.194 · how far apart the two teachers sit on this one work
Validation statusscore_only:v0-immature-baseline · verbatim from the scoring run: score_only means the number may rank works, and no category label ships from it

Classification

machine, unvalidated

Machine predicted; a candidate call from one teacher head, not a consensus.

Study designBench or experimental
Domainnot available
GenreEmpirical

How this classification was reached, model by model and score by score, is at the end of the page under "How this classification was reached".

Quick stats

Citations12
Published2018
Admission routes2
Has abstractyes

Explore more

Same venueCellular and Molecular Gastroenterology and HepatologySame topicInflammatory Bowel DiseaseFrench-language works237,207